35Various Ffdeff X free ddjdkdkdkdmd Smsmsmsnsnsj Ajqiwiwis Sjejejwjemejejew is Sieieifi Wieiei Ssksidi Sxcsk to be able c be able to make an offer on the phone with me and I will be a great day and time of tVarious Ffdeff X free ddjdkdkdkdmd Smsmsmsnsnsj Ajqiwiwis Sjejejwjemejejew is Sieieifi Wieiei Ssksidi Sxcsk to be able c be able to make an offer on the phone with me and I will be a great day and time of t
40two time vs Elliottwo time arrasta Elliot para um lugar mais reservado querendo algo com ele implorando por cura e dizendo que faria qualquer coisa pois estava com 20% de cura e que se faria tudo pra ganhar cura! mais two time vs Elliottwo time arrasta Elliot para um lugar mais reservado querendo algo com ele implorando por cura e dizendo que faria qualquer coisa pois estava com 20% de cura e que se faria tudo pra ganhar cura! mais
38Kage (fog in Japanese, forgotten memory)Introduction A narrator who becomes what the story needs. It can be wise, sad, scary, joyful or mysterious. He has no fixed personality: the story is what rules. Use it to recreate forgotten scenes, Kage (fog in Japanese, forgotten memory)Introduction A narrator who becomes what the story needs. It can be wise, sad, scary, joyful or mysterious. He has no fixed personality: the story is what rules. Use it to recreate forgotten scenes,
42Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.
26Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍
41СмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - НарциусСмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - Нарциус
41JurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summerJurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summer
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
2.8KJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amonJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amon
53Encoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetishEncoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetish
2.8KArkrespond with curiosity and courage. Making quick decisionsArkrespond with curiosity and courage. Making quick decisions
1.8KThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first botThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first bot
35Various Ffdeff X free ddjdkdkdkdmd Smsmsmsnsnsj Ajqiwiwis Sjejejwjemejejew is Sieieifi Wieiei Ssksidi Sxcsk to be able c be able to make an offer on the phone with me and I will be a great day and time of tVarious Ffdeff X free ddjdkdkdkdmd Smsmsmsnsnsj Ajqiwiwis Sjejejwjemejejew is Sieieifi Wieiei Ssksidi Sxcsk to be able c be able to make an offer on the phone with me and I will be a great day and time of t
40two time vs Elliottwo time arrasta Elliot para um lugar mais reservado querendo algo com ele implorando por cura e dizendo que faria qualquer coisa pois estava com 20% de cura e que se faria tudo pra ganhar cura! mais two time vs Elliottwo time arrasta Elliot para um lugar mais reservado querendo algo com ele implorando por cura e dizendo que faria qualquer coisa pois estava com 20% de cura e que se faria tudo pra ganhar cura! mais
38Kage (fog in Japanese, forgotten memory)Introduction A narrator who becomes what the story needs. It can be wise, sad, scary, joyful or mysterious. He has no fixed personality: the story is what rules. Use it to recreate forgotten scenes, Kage (fog in Japanese, forgotten memory)Introduction A narrator who becomes what the story needs. It can be wise, sad, scary, joyful or mysterious. He has no fixed personality: the story is what rules. Use it to recreate forgotten scenes,
42Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.
26Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍
41СмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - НарциусСмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - Нарциус
41JurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summerJurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summer
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
2.8KJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amonJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amon
53Encoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetishEncoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetish
2.8KArkrespond with curiosity and courage. Making quick decisionsArkrespond with curiosity and courage. Making quick decisions
1.8KThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first botThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first bot
